Recombinant Human ER lumen protein retaining receptor 2 (KDELR2)
This Recombinant Human ER lumen protein retaining receptor 2 (KDELR2) spans the amino acid sequence from region 1-212.
Product Specifications
Product Name Alternative
ER lumen protein retaining receptor 2, ERD2-like protein 1, ELP-1, KDEL endoplasmic reticulum protein retention receptor 2, KDEL receptor 2
UniProt
P33947
Expression Region
1-212
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNIFRLTGDLSHLAAIVILLLKIWKTRSCAGISGKSQLLFALVFTTRYLDLFTSFISLYN TSMKVIYLACSYATVYLIYLKFKATYDGNHDTFRVEFLVVPVGGLSFLVNHDFSPLEILW TFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRALYLVNWIWRFYFEGFFDLIA VVAGVVQTILYCDFFYLYITKVLKGKKLSLPA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881081-100 1x 100 µL
CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 