Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ER lumen protein retaining receptor (erd-2)

This Recombinant ER lumen protein retaining receptor (erd-2) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

ER lumen protein retaining receptor

UniProt

P48583

Expression Region

1-213

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLFRFTADVAHAIAIVVLLLKIWKSRSCEGISGRSQLLFALVFVTRYLDLFTNFFSFYN TAMKIFYLVASFGTVYLMWAKFKATYDRNNDSFRIEFLVIPSMILALLINHEFIFMEVMW TFSIYLEAVAIMPQLFMLSRTGNAETITAHYLFALGSYRFLYILNWVYRYYTESFFDPIS VVAGIVQTVLYADFFYLYITRVIQSNRQFEMSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SKA2 activation kit by CRISPRa
GA117677 1 Kit

Human SKA2 activation kit by CRISPRa

Sign In for Pricing
View Details
1,1,1,2,2-Pentafluoro-4-iodobutane
TRC-P270310-5G 5 g

1,1,1,2,2-Pentafluoro-4-iodobutane

Sign In for Pricing
View Details
Recombinant LIN28 Antibody
RC-16903-01 50 μL

Recombinant LIN28 Antibody

Sign In for Pricing
View Details
Recombinant LIN28 Antibody
RC-16903-02 100 µL

Recombinant LIN28 Antibody

Sign In for Pricing
View Details
Recombinant LIN28 Antibody
RC-16903-03 1 mL

Recombinant LIN28 Antibody

Sign In for Pricing
View Details
INCA1 (NM_213726) Human Over-expression Lysate
LY403740 100 µg

INCA1 (NM_213726) Human Over-expression Lysate

Sign In for Pricing
View Details