Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ER lumen protein retaining receptor (erd-2)

This Recombinant ER lumen protein retaining receptor (erd-2) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

ER lumen protein retaining receptor

UniProt

P48583

Expression Region

1-213

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNLFRFTADVAHAIAIVVLLLKIWKSRSCEGISGRSQLLFALVFVTRYLDLFTNFFSFYN TAMKIFYLVASFGTVYLMWAKFKATYDRNNDSFRIEFLVIPSMILALLINHEFIFMEVMW TFSIYLEAVAIMPQLFMLSRTGNAETITAHYLFALGSYRFLYILNWVYRYYTESFFDPIS VVAGIVQTVLYADFFYLYITRVIQSNRQFEMSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM204 Human Gene Knockout Kit (CRISPR)
KN402534 1 Kit

TMEM204 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MYADM activation kit by CRISPRa
GA114139 1 Kit

Human MYADM activation kit by CRISPRa

Sign In for Pricing
View Details
CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF647 conjugate, 0.1mg/mL
BNC470988-500 1x 500 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pgpep1 (NM_023217) Mouse Tagged ORF Clone
MG202232 10 µg

Pgpep1 (NM_023217) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF568 conjugate, 0.1mg/mL
BNC682363-500 1x 500 µL

FOLH1 / PSMA (Prostate Epithelial Marker) (FOLH1/2363), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCDC66 (NM_001141947) Human Over-expression Lysate
LY427984 100 µg

CCDC66 (NM_001141947) Human Over-expression Lysate

Sign In for Pricing
View Details