Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Hemolysin-3 homolog (yplQ)

This Recombinant Bacillus subtilis Hemolysin-3 homolog (yplQ) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

Hemolysin-3 homolog, Hemolysin III homolog

UniProt

P54175

Expression Region

1-213

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFTIKEEIANAITHGIGVLLSIPALVFLIIFAANYGSAWDIVSFTIFGVSMLLLYLSSTL LHSITHKKTKDILEIIDHSAIYVLIAGTYTPFLLGPLKGTLGFTLLVIVWSLALGGIVFK IFFVKRFILLSTFVYLVMGWLMIIAVKPLYASLSGAGFSLLFLGGILYSVGTIFYIWKKI PFHHAIWHSFVLGGSAAMFFCVLFYCVKVPFLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL
BNC680039-100 1x 100 µL

CD34 (ICO-115), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
BNC470031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-100 1x 100 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (8D6), CF488A conjugate, 0.1mg/mL
BNC880424-100 1x 100 µL

CD147 (8D6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), Biotin conjugate, 0.1mg/mL
BNCB2216-100 1x 100 µL

CD50 / ICAM3 (CG106), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (123C3.D5 + 123A8), CF640R conjugate, 0.1mg/mL
BNC400693-100 1x 100 µL

CD56 / NCAM (123C3.D5 + 123A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details