Recombinant Human Putative protein SLC9B1-like 1
This Recombinant Human Putative protein SLC9B1-like 1 spans the amino acid sequence from region 1-215.
Product Specifications
Product Name Alternative
Putative protein SLC9B1-like 1
UniProt
A6NJY1
Expression Region
1-215
Origin
Homo sapiens (Human)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVLQENGYGVEEDIPTLLMAASSMDDLLAITGFNTCLSIVFYSGGMINNAIASLRNVCIS LLAGIVLGFFVRYFPSEDQKKITLKRGFLVLITFVSAVLGSQPIGLHGSGGLCTLVLHFI EWTKWSQEKMKVQKIITNVWDIFQPLLFGLVGAEVSVSLLESNIVGISVSTLSLALCVRI LNIYLLMCFAGFSFKEKIFIALAWMPKATVQVRTY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C7510-57J 1 mL
Collagen Type V (Collagen-V, Alpha 1 Type V Collagen, Collagen alpha-1 (V) Chain, Collagen Type V alpha 1, Col5A1, Alpha 2 Type V Collagen, Collagen alpha-2 (V) Chain, Collagen Type V alpha 2, Collagen V alpha 2 Polypeptide, Col5A2, Collagen alpha-3 (V) Chain, Collagen Type V alpha 3, Col5A3, AB Collagen, Pro-alpha-1 Type V Collagen, Pro alpha 3 (V) Collagen, Type V Preprocollagen alpha 2 Chain) discontinued
Sign In for Pricing
View Details