Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hydrogenase-4 component E (hyfE)

This Recombinant Hydrogenase-4 component E (hyfE) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Hydrogenase-4 component E, EC= 1.-.-.-

UniProt

P0AEW2

Expression Region

1-216

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG16 (Autophagy-Related Protein 16) (PE)
214520-PE 100 µL

ATG16 (Autophagy-Related Protein 16) (PE)

Sign In for Pricing
View Details
SLC26A10P Rabbit Polyclonal Antibody (Biotin)
orb3093215 100 µg

SLC26A10P Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PATL2, ID (PATL2, Protein PAT1 homolog 2, PAT1-like protein 2, Protein PAT1 homolog a) (MaxLight 750) discontinued
039695-ML750 100 µL

PATL2, ID (PATL2, Protein PAT1 homolog 2, PAT1-like protein 2, Protein PAT1 homolog a) (MaxLight 750) discontinued

Sign In for Pricing
View Details
SLC5A9 Antibody
orb1259719 100 µL

SLC5A9 Antibody

Sign In for Pricing
View Details
Nessler's reagent for ammonia determination
LC-10908.1 1 L

Nessler's reagent for ammonia determination

Sign In for Pricing
View Details
Lentiviral human CD164 sgRNA gene knockout kit - Lentiviral human CD164 sgRNA gene knockout kit (100)
GTR15392617 1 Vial

Lentiviral human CD164 sgRNA gene knockout kit - Lentiviral human CD164 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details