Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Hydrogenase-4 component E (hyfE)

This Recombinant Escherichia coli Hydrogenase-4 component E (hyfE) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Hydrogenase-4 component E, EC= 1.-.-.-

UniProt

P0AEW1

Expression Region

1-216

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

7-Xylosyl-10-deacetyltaxol C
379412 5 mg

7-Xylosyl-10-deacetyltaxol C

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae yfbJ Protein (aa 1-126)
VAng-Cr5558-inquire Inquire

Recombinant Klebsiella Pneumoniae yfbJ Protein (aa 1-126)

Sign In for Pricing
View Details
Rabbit Polyclonal ANKRD45 Antibody
NBP1-85421 0.1 mL

Rabbit Polyclonal ANKRD45 Antibody

Sign In for Pricing
View Details
Anti-ZNF227 Antibody
CPA2250-01 30 µL

Anti-ZNF227 Antibody

Sign In for Pricing
View Details
Anti-ZNF227 Antibody
CPA2250-02 50 μL

Anti-ZNF227 Antibody

Sign In for Pricing
View Details
Anti-ZNF227 Antibody
CPA2250-03 100 µL

Anti-ZNF227 Antibody

Sign In for Pricing
View Details