Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Hydrogenase-4 component E (hyfE)

This Recombinant Escherichia coli Hydrogenase-4 component E (hyfE) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Hydrogenase-4 component E, EC= 1.-.-.-

UniProt

P0AEW1

Expression Region

1-216

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Insulin Recombinant Antibody, PE Conjugated
bsm-60010R-PE 100 µL

Insulin Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Aeromonas Salmonicida panB Protein
VAng-Lsx1307-500gEcoli 500 µg (E. coli)

Recombinant Aeromonas Salmonicida panB Protein

Sign In for Pricing
View Details
Rabbit PLVAP (Plasmalemma Vesicle Associated Protein) ValidElisa Kit
EK346704 96 Well

Rabbit PLVAP (Plasmalemma Vesicle Associated Protein) ValidElisa Kit

Sign In for Pricing
View Details
Anti-REXO2 Rabbit pAb
GB114183-100 100 μL

Anti-REXO2 Rabbit pAb

Sign In for Pricing
View Details
Athl1 (BC023151) Mouse Tagged ORF Clone Lentiviral Particle
MR208359L4V 200 µL

Athl1 (BC023151) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Selectin, Endothelium (SELE)
MBS2035408-01 0.1 mL

PE-Linked Polyclonal Antibody to Selectin, Endothelium (SELE)

Sign In for Pricing
View Details