Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Hydrogenase-4 component E (hyfE)

This Recombinant Escherichia coli Hydrogenase-4 component E (hyfE) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Hydrogenase-4 component E, EC= 1.-.-.-

UniProt

P0AEW1

Expression Region

1-216

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mab21l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
27877114 3x 1.0 µg

Mab21l1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Vibrio Cholerae Panel
PH2001441-01 16 Reactions

Vibrio Cholerae Panel

Sign In for Pricing
View Details
Vibrio Cholerae Panel
PH2001441-02 16 Reactions

Vibrio Cholerae Panel

Sign In for Pricing
View Details
ZFYVE16, NT (ZFYVE16, KIAA0305, Zinc finger FYVE domain-containing protein 16, Endofin, Endosome-associated FYVE domain protein) (Azide free) (HRP) discontinued
044078-HRP 200 µL

ZFYVE16, NT (ZFYVE16, KIAA0305, Zinc finger FYVE domain-containing protein 16, Endofin, Endosome-associated FYVE domain protein) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Serine Dehydratase Antibody (OTI3D3) [FITC]
NBP2-74074F 0.1 mL

Mouse Monoclonal Serine Dehydratase Antibody (OTI3D3) [FITC]

Sign In for Pricing
View Details
CLUL1 Antibody - middle region : HRP (ARP55044_P050-HRP)
ARP55044_P050-HRP 100 µL

CLUL1 Antibody - middle region : HRP (ARP55044_P050-HRP)

Sign In for Pricing
View Details