Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hydrogenase-4 component E (hyfE)

This Recombinant Hydrogenase-4 component E (hyfE) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Hydrogenase-4 component E, EC= 1.-.-.-

UniProt

P0AEW3

Expression Region

1-216

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAR20 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV753802 1.0 µg DNA

TRNAR20 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Lentiviral human KIAA1107 shRNA (UAS) - Lentiviral human KIAA1107 shRNA (UAS) (100)
GTR15137154 1 Vial

Lentiviral human KIAA1107 shRNA (UAS) - Lentiviral human KIAA1107 shRNA (UAS) (100)

Sign In for Pricing
View Details
HBsAg Polyclonal Antibody, HRP Conjugated
bs-1557G-HRP 100 µL

HBsAg Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
RNF32 HDR Plasmid (m)
sc-425333-HDR 20 µg

RNF32 HDR Plasmid (m)

Sign In for Pricing
View Details
Ring Finger Protein 40 (RNF40, 95kD Retinoblastoma Protein Binding Protein, BRE1B, BRE1-B, DKFZp686K191, E3 Ubiquitin Protein Ligase BRE1B, KIAA0661, MGC13051, Rb-associated Protein, RBP95, STARING) (MaxLight 405)
MBS6402016-01 0.1 mL

Ring Finger Protein 40 (RNF40, 95kD Retinoblastoma Protein Binding Protein, BRE1B, BRE1-B, DKFZp686K191, E3 Ubiquitin Protein Ligase BRE1B, KIAA0661, MGC13051, Rb-associated Protein, RBP95, STARING) (MaxLight 405)

Sign In for Pricing
View Details
Ring Finger Protein 40 (RNF40, 95kD Retinoblastoma Protein Binding Protein, BRE1B, BRE1-B, DKFZp686K191, E3 Ubiquitin Protein Ligase BRE1B, KIAA0661, MGC13051, Rb-associated Protein, RBP95, STARING) (MaxLight 405)
MBS6402016-02 5x 0.1 mL

Ring Finger Protein 40 (RNF40, 95kD Retinoblastoma Protein Binding Protein, BRE1B, BRE1-B, DKFZp686K191, E3 Ubiquitin Protein Ligase BRE1B, KIAA0661, MGC13051, Rb-associated Protein, RBP95, STARING) (MaxLight 405)

Sign In for Pricing
View Details