Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hydrogenase-4 component E (hyfE)

This Recombinant Hydrogenase-4 component E (hyfE) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Hydrogenase-4 component E, EC= 1.-.-.-

UniProt

P0AEW3

Expression Region

1-216

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ablim1 (NM_001103178) Mouse Tagged Lenti ORF Clone
MR222518L3 10 µg

Ablim1 (NM_001103178) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PRKCI (Protein Kinase C, iota, DXS1179E, MGC26534, PKCI, nPKC-iota)
250486 100 µg

PRKCI (Protein Kinase C, iota, DXS1179E, MGC26534, PKCI, nPKC-iota)

Sign In for Pricing
View Details
KIF3B (Kinesin Family Member 3B, HH0048, KIAA0359) (MaxLight 650)
247905-ML650 100 µL

KIF3B (Kinesin Family Member 3B, HH0048, KIAA0359) (MaxLight 650)

Sign In for Pricing
View Details
Mrgpra2b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3281102 1.0 µg DNA

Mrgpra2b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-1/CD169 Antibody (HSn 7D2) [PerCP]
NB600-534PCP 0.1 mL

Mouse Monoclonal Siglec-1/CD169 Antibody (HSn 7D2) [PerCP]

Sign In for Pricing
View Details
Mouse Polyclonal LRIT3 Antibody
H00345193-B01P 0.05 mg

Mouse Polyclonal LRIT3 Antibody

Sign In for Pricing
View Details