Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hydrogenase-4 component E (hyfE)

This Recombinant Hydrogenase-4 component E (hyfE) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Hydrogenase-4 component E, EC= 1.-.-.-

UniProt

P0AEW3

Expression Region

1-216

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTGSMIVNNLAGLMMLTSLFVISVKSYRLSCGFYACQSLVLVSIFATLSCLFAAEQLLIW SASAFITKVLLVPLIMTYAARNIPQNIPEKALFGPAMMALLAALIVLLCAFVVQPVKLPM ATGLKPALAVALGHFLLGLLCIVSQRNILRQIFGYCLMENGSHLVLALLAWRAPELVEIG IATDAIFAVIVMVLLARKIWRTHGTLDVNNLTALKG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Neuregulin 3 ELISA Kit
MBS075173-01 48 Well

Hamster Neuregulin 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Neuregulin 3 ELISA Kit
MBS075173-02 96 Well

Hamster Neuregulin 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Neuregulin 3 ELISA Kit
MBS075173-03 5x 96 Well

Hamster Neuregulin 3 ELISA Kit

Sign In for Pricing
View Details
Hamster Neuregulin 3 ELISA Kit
MBS075173-04 10x 96 Well

Hamster Neuregulin 3 ELISA Kit

Sign In for Pricing
View Details
ISL1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
25124154 3x 1.0 µg DNA

ISL1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
MIP-2, Recombinant, Rat (GRO-beta, Growth Regulated Protein/Melanoma Growth Stimulatory Activity, GRO a, MGSA a, CXCL1, NAP-3, GRO1, KC (mouse) CINC (rat) ) discontinued
220061 20 µg

MIP-2, Recombinant, Rat (GRO-beta, Growth Regulated Protein/Melanoma Growth Stimulatory Activity, GRO a, MGSA a, CXCL1, NAP-3, GRO1, KC (mouse) CINC (rat) ) discontinued

Sign In for Pricing
View Details