Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yjbE (yjbE)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yjbE (yjbE) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yjbE

UniProt

O31603

Expression Region

1-218

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHDYLISLLVIVGIDLILGGDNAVVIAMASRHLPDKQRQQAIILGTFIAVAMRIGLTSA AVYLLNIPFLQCAGGIFLLYLGYQLLIEKKDTKHIKSSTSLWRAIRTIVLADLFMSLDNV IAVAGASHGEFSLVVIGLCVSVPVIIWGSKLIHIALEKIPLLIYAGSGLLAYTGGEMIVR DKKLSLFMAQHGTVETLLPILTVAFVILASIYYQQVEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human peroxisome proliferators activator receptors alpha,PPAR-α ELISA Kit
CN-03743H2 48T

Human peroxisome proliferators activator receptors alpha,PPAR-α ELISA Kit

Sign In for Pricing
View Details
BPDEtide (Protein Kinase G Substrate)
B2630 1 mg

BPDEtide (Protein Kinase G Substrate)

Sign In for Pricing
View Details
Tns4 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3885103 1.0 µg DNA

Tns4 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Dnd1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7542502 1.0 µg DNA

Dnd1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Chicken Olfactory Receptor 7G3 (OR7G3) ELISA Kit
MBS7265364-01 48 Well

Chicken Olfactory Receptor 7G3 (OR7G3) ELISA Kit

Sign In for Pricing
View Details
Chicken Olfactory Receptor 7G3 (OR7G3) ELISA Kit
MBS7265364-02 96 Well

Chicken Olfactory Receptor 7G3 (OR7G3) ELISA Kit

Sign In for Pricing
View Details