Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yjbE (yjbE)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yjbE (yjbE) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yjbE

UniProt

O31603

Expression Region

1-218

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHDYLISLLVIVGIDLILGGDNAVVIAMASRHLPDKQRQQAIILGTFIAVAMRIGLTSA AVYLLNIPFLQCAGGIFLLYLGYQLLIEKKDTKHIKSSTSLWRAIRTIVLADLFMSLDNV IAVAGASHGEFSLVVIGLCVSVPVIIWGSKLIHIALEKIPLLIYAGSGLLAYTGGEMIVR DKKLSLFMAQHGTVETLLPILTVAFVILASIYYQQVEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNIPL sgRNA CRISPR Lentivector (Human) (Target 2)
K0190703 1.0 µg DNA

BNIPL sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human PRKN Protein Lysate 20ug
IHUPRKNPLLY20UG 20 µg

Human PRKN Protein Lysate 20ug

Sign In for Pricing
View Details
Lentiviral human CCDC74B shRNA (UAS) - Lentiviral human CCDC74B shRNA (UAS, GFP) (25)
GTR15084512 1 Vial

Lentiviral human CCDC74B shRNA (UAS) - Lentiviral human CCDC74B shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Human ADRA2B knockdown cell line
ABC-KD0346 1 Vial

Human ADRA2B knockdown cell line

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cytokeratin 19 (CK19)
MBS2165309-01 0.1 mL

APC-Linked Polyclonal Antibody to Cytokeratin 19 (CK19)

Sign In for Pricing
View Details
APC-Linked Polyclonal Antibody to Cytokeratin 19 (CK19)
MBS2165309-02 0.2 mL

APC-Linked Polyclonal Antibody to Cytokeratin 19 (CK19)

Sign In for Pricing
View Details