Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein YccA (yccA)

This Recombinant Inner membrane protein YccA (yccA) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Inner membrane protein YccA

UniProt

P0AAC7

Expression Region

1-219

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRIVSSSHDRTSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMY GLMFLTYKTANKPTGIISAFAFTGFLGYILGPILNTYLSAGMGDVIAMALGGTALVFFCC SAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILFET SNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCTAIRE2 Polyclonal Antibody, Cy7 Conjugated
bs-11574R-Cy7 100 µL

PCTAIRE2 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-6His)
MBS2569323-01 0.01 mg

Recombinant Mouse Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-6His)
MBS2569323-02 0.05 mg

Recombinant Mouse Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-6His)
MBS2569323-03 5x 0.05 mg

Recombinant Mouse Sialic acid-binding Ig-like lectin 15/Siglec-15/CD33L3 (C-6His)

Sign In for Pricing
View Details
OR5A2 siRNA (Human)
MBS8204112-01 15 nmol

OR5A2 siRNA (Human)

Sign In for Pricing
View Details
OR5A2 siRNA (Human)
MBS8204112-02 30 nmol

OR5A2 siRNA (Human)

Sign In for Pricing
View Details