What is the catalog number for Recombinant Inner membrane protein YccA (yccA)?

The catalog number for Recombinant Inner membrane protein YccA (yccA) is orb2908370.

What sizes are available for Recombinant Inner membrane protein YccA (yccA)?

Recombinant Inner membrane protein YccA (yccA) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Inner membrane protein YccA (yccA) come in?

Recombinant Inner membrane protein YccA (yccA) is available in 2 different pack sizes.

Is Recombinant Inner membrane protein YccA (yccA) in stock?

Recombinant Inner membrane protein YccA (yccA) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Inner membrane protein YccA (yccA)

This Recombinant Inner membrane protein YccA (yccA) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Inner membrane protein YccA

UniProt

P0AAC7

Expression Region

1-219

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRIVSSSHDRTSLLSTHKVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMY GLMFLTYKTANKPTGIISAFAFTGFLGYILGPILNTYLSAGMGDVIAMALGGTALVFFCC SAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILFET SNIIHGGETNYIRATVSLYVSLYNIFVSLLSILGFASRD