Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Plasmodium falciparum ER lumen protein retaining receptor (ERD2)

This Recombinant Plasmodium falciparum ER lumen protein retaining receptor (ERD2) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

ER lumen protein retaining receptor

UniProt

Q76NM1

Expression Region

1-221

Origin

Plasmodium falciparum (isolate 3D7)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIFRLIGDILHLVSMYILIMKLKKSKNCIGISCRMQELYLIVFLCRYIDLFFVFVSFYN TVMKITFILTIAYTIYLIRLKLPISQTYNRKVDNFKSEKYLIPPCLVLSLLTCKTYNLYN ILWSFSIWLESVAILPQLVLLEKQREVENITSHYVITMGLYRAFYILNWIYRYFFDDKPY INVVGWIGGLIQTLLYIDFFYYFALAKWYGKKLVLPFNGEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL
BNC740806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL
BNC400994-100 1x 100 µL

TNF alpha (J2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (TFRC/1149), CF640R conjugate, 0.1mg/mL
BNC401149-100 1x 100 µL

CD71 (TFRC/1149), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details