Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sugar transporter SWEET1 (SLC50A1)

This Recombinant Human Sugar transporter SWEET1 (SLC50A1) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

Sugar transporter SWEET1, HsSWEET1, RAG1-activating protein 1, Solute carrier family 50 member 1, Stromal cell protein

UniProt

Q9BRV3

Expression Region

1-221

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY GALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP NPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGF RLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trap1 Antibody: PerCP
SMC-207D-PCP 100 µg

Trap1 Antibody: PerCP

Sign In for Pricing
View Details
TCL1 (T-Cell Marker) (TCL1/2079), CF640R conjugate, 0.1mg/mL
BNC402079-100 1x 100 µL

TCL1 (T-Cell Marker) (TCL1/2079), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Fgr activation kit by CRISPRa
GA201415 1 Kit

Mouse Fgr activation kit by CRISPRa

Sign In for Pricing
View Details
Optional eight channel adapter, fine tip stainless steel
V1002-S8 1 Each

Optional eight channel adapter, fine tip stainless steel

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF594 conjugate, 0.1mg/mL
BNC940950-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (D5 + MITF/915), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1orf226 Human Gene Knockout Kit (CRISPR)
KN422073 1 Kit

C1orf226 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details