Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sugar transporter SWEET1 (SLC50A1)

This Recombinant Human Sugar transporter SWEET1 (SLC50A1) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

Sugar transporter SWEET1, HsSWEET1, RAG1-activating protein 1, Solute carrier family 50 member 1, Stromal cell protein

UniProt

Q9BRV3

Expression Region

1-221

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAGGFLDSLIYGACVVFTLGMFSAGLSDLRHMRMTRSVDNVQFLPFLTTEVNNLGWLSY GALKGDGILIVVNTVGAALQTLYILAYLHYCPRKRVVLLQTATLLGVLLLGYGYFWLLVP NPEARLQQLGLFCSVFTISMYLSPLADLAKVIQTKSTQCLSYPLTIATLLTSASWCLYGF RLRDPYIMVSNFPGIVTSFIRFWLFWKYPQEQDRNYWLLQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDRG1 Antibody
8C17587-AAT 50 µg

PDRG1 Antibody

Sign In for Pricing
View Details
HPS5 Polyclonal Antibody
E-AB-90337-01 60 µL

HPS5 Polyclonal Antibody

Sign In for Pricing
View Details
HPS5 Polyclonal Antibody
E-AB-90337-02 120 µL

HPS5 Polyclonal Antibody

Sign In for Pricing
View Details
HPS5 Polyclonal Antibody
E-AB-90337-03 200 µL

HPS5 Polyclonal Antibody

Sign In for Pricing
View Details
Urazole
TRC-U815405-50MG 50 mg

Urazole

Sign In for Pricing
View Details
TRIM25 Rabbit Monoclonal Antibody
TA423311 100 µL

TRIM25 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details