Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Lysoplasmalogenase (TMEM86B)

This Recombinant Bovine Lysoplasmalogenase (TMEM86B) spans the amino acid sequence from region 1-224.

Product Specifications

Product Name Alternative

Lysoplasmalogenase, EC= 3.3.2.2, EC= 3.3.2.5, Transmembrane protein 86B

UniProt

Q3T0W0

Expression Region

1-224

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDARKEGLLRKPRFSAQPRVGMGLLPFFLACAVYLLVRNADQPPWVNVLLKILPVLYLAG FLGTAHPGGGYRALLQGALLCSAVGDACLVWPEALRYGMAAFGLAHLLYLRAFGLTPLKP GLLLPLLLVSALYFRVLHPHMPPQVVWPLLAYSIVLVAMLWRGLARGGSAHWGALLFVLS DSVLAWNIFTYLVPHGHLLVMTTYYSAQMLITLSAFQNPRLKSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBL sgRNA CRISPR Lentivector (Human) (Target 2)
K0368603 1.0 µg DNA

CBL sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
ARHGEF10L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
12321111 3x 1.0 µg

ARHGEF10L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Nphs2 3'UTR Lenti-reporter-Luc Vector
32061086 1.0 µg

Nphs2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Tau Antibody
MBS9504290-01 0.05 mL

Tau Antibody

Sign In for Pricing
View Details
Tau Antibody
MBS9504290-02 0.1 mL

Tau Antibody

Sign In for Pricing
View Details
Tau Antibody
MBS9504290-03 5x 0.1 mL

Tau Antibody

Sign In for Pricing
View Details