Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Lysoplasmalogenase (TMEM86B)

This Recombinant Bovine Lysoplasmalogenase (TMEM86B) spans the amino acid sequence from region 1-224.

Product Specifications

Product Name Alternative

Lysoplasmalogenase, EC= 3.3.2.2, EC= 3.3.2.5, Transmembrane protein 86B

UniProt

Q3T0W0

Expression Region

1-224

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDARKEGLLRKPRFSAQPRVGMGLLPFFLACAVYLLVRNADQPPWVNVLLKILPVLYLAG FLGTAHPGGGYRALLQGALLCSAVGDACLVWPEALRYGMAAFGLAHLLYLRAFGLTPLKP GLLLPLLLVSALYFRVLHPHMPPQVVWPLLAYSIVLVAMLWRGLARGGSAHWGALLFVLS DSVLAWNIFTYLVPHGHLLVMTTYYSAQMLITLSAFQNPRLKSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif1 sgRNA CRISPR Lentivector set (Rat)
K6044101 3x 1.0 µg

Eif1 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
HOOK3 CRISPR/Cas9 KO Plasmid (h)
sc-413639 20 µg

HOOK3 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Recombinant Human NCOA5, GST-tagged
NCOA5-1215H 25 µg

Recombinant Human NCOA5, GST-tagged

Sign In for Pricing
View Details
PPP2R5E Rabbit mAb
E2R27197 100 µL

PPP2R5E Rabbit mAb

Sign In for Pricing
View Details
Chromodomain-Helicase-DNA-Binding Protein 5 (CHD5) Antibody (FITC)
abx316438-01 20 µg

Chromodomain-Helicase-DNA-Binding Protein 5 (CHD5) Antibody (FITC)

Sign In for Pricing
View Details
Chromodomain-Helicase-DNA-Binding Protein 5 (CHD5) Antibody (FITC)
abx316438-02 50 µg

Chromodomain-Helicase-DNA-Binding Protein 5 (CHD5) Antibody (FITC)

Sign In for Pricing
View Details