Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus tusciae Cobalt transport protein CbiM (cbiM)

This Recombinant Bacillus tusciae Cobalt transport protein CbiM (cbiM) spans the amino acid sequence from region 22-247.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiM, Energy-coupling factor transporter probable substrate-capture protein CbiM, ECF transporter S component CbiM

UniProt

D5WSC8

Expression Region

22-247

Origin

Bacillus tusciae (strain DSM 2912 / NBRC 15312 / T2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHIMEGYLPLGWCLFWAALCLPALILGTRSLQKQVGDNLRMKLVLALSAAFAFVLSALKL PSVTGSSSHPTGVGLGAVLFGPMAMSVVGCIILLFQALLLAHGGITTLGANTFSMAVVGP TVSYVVFRIFQKSGFGRGVAVFLAAALGDLSTYLTTSLQLALAFPAPIGGVASSFWKFAS IFAVTQVPLAVSEGLLTVIMVNWVMKYSPEVLSRAMNLPEEGHHEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL
BNC470178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
BNC680181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF740 conjugate, 0.1mg/mL
BNC740012-100 1x 100 µL

Tyrosinase (T311), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details