Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysoplasmalogenase (Tmem86b)

This Recombinant Mouse Lysoplasmalogenase (Tmem86b) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Lysoplasmalogenase, EC= 3.3.2.2, EC= 3.3.2.5, Transmembrane protein 86B

UniProt

Q497J1

Expression Region

1-226

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDARKEGLPLETLFSDQYPQVRRWLAPFILACSLYFLLWIPVDQPSWVSALIKCQPILCL VVFLWAVAPGGSSTWLLQGALVCSAVGDACLIWPEAFFYGTAAFSVAHLFYLGAFGLTPL QPGLLLCTTLASLTYYSFLLLHLEQGMVLPVMAYGLILNSMLWRSLVWGGSASWGAVLFT FSDGVLAWDTFVYSLPFARLVTMSTYYAAQLLLILSALRNPGLKTH

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Hsd17b11 antibody - middle region
APR16727G 0.05mg

Polyclonal Hsd17b11 antibody - middle region

Sign In for Pricing
View Details
YfbV Antibody
orb830757 2 mg

YfbV Antibody

Sign In for Pricing
View Details
Human CCL15 ELISA Kit
orb406550-01 24 Tests

Human CCL15 ELISA Kit

Sign In for Pricing
View Details
Human CCL15 ELISA Kit
orb406550-02 48 Tests

Human CCL15 ELISA Kit

Sign In for Pricing
View Details
Human CCL15 ELISA Kit
orb406550-03 96 Tests

Human CCL15 ELISA Kit

Sign In for Pricing
View Details
Human CCL15 ELISA Kit
orb406550-04 5 x 96 T

Human CCL15 ELISA Kit

Sign In for Pricing
View Details