Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysoplasmalogenase (Tmem86b)

This Recombinant Mouse Lysoplasmalogenase (Tmem86b) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Lysoplasmalogenase, EC= 3.3.2.2, EC= 3.3.2.5, Transmembrane protein 86B

UniProt

Q497J1

Expression Region

1-226

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDARKEGLPLETLFSDQYPQVRRWLAPFILACSLYFLLWIPVDQPSWVSALIKCQPILCL VVFLWAVAPGGSSTWLLQGALVCSAVGDACLIWPEAFFYGTAAFSVAHLFYLGAFGLTPL QPGLLLCTTLASLTYYSFLLLHLEQGMVLPVMAYGLILNSMLWRSLVWGGSASWGAVLFT FSDGVLAWDTFVYSLPFARLVTMSTYYAAQLLLILSALRNPGLKTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NNC 55-0396 100mg
A15188-100 100 mg

NNC 55-0396 100mg

Sign In for Pricing
View Details
ALDH7A1 (Antiquitin-1, Aldehyde Dehydrogenase Family 7 Member A1, Delta1-piperideine-6-carboxylate Dehydrogenease, P6c Dehydrogenase, Alpha-aminoadipic Semialdehyde Dehydrogenase, Alpha-AASA Dehydrogenase, Betaine Aldehyde Dehydrogenase, ATQ1) (FITC)
123218-FITC 100 µL

ALDH7A1 (Antiquitin-1, Aldehyde Dehydrogenase Family 7 Member A1, Delta1-piperideine-6-carboxylate Dehydrogenease, P6c Dehydrogenase, Alpha-aminoadipic Semialdehyde Dehydrogenase, Alpha-AASA Dehydrogenase, Betaine Aldehyde Dehydrogenase, ATQ1) (FITC)

Sign In for Pricing
View Details
FEN1 Peptide - C-terminal region
MBS3247013-01 0.1 mg

FEN1 Peptide - C-terminal region

Sign In for Pricing
View Details
FEN1 Peptide - C-terminal region
MBS3247013-02 5x 0.1 mg

FEN1 Peptide - C-terminal region

Sign In for Pricing
View Details
(R) - (-) -Isobornylamine hydrochloride
sc-229054 100 mg

(R) - (-) -Isobornylamine hydrochloride

Sign In for Pricing
View Details
Goat Anti-CHRNB1 / ACHRB Antibody
OAEB01105-100UG 100 µg

Goat Anti-CHRNB1 / ACHRB Antibody

Sign In for Pricing
View Details