Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Lysoplasmalogenase (TMEM86B)

This Recombinant Pig Lysoplasmalogenase (TMEM86B) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Lysoplasmalogenase, EC= 3.3.2.2, EC= 3.3.2.5, Transmembrane protein 86B

UniProt

F1RMN2

Expression Region

1-226

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPGKEGLPRKPRFSAQQLHVGKWLSPFFFTCAVYFLLWIPDDQPSWVGALVKCLPVLSL VVFLRAVDAGGGYSARLQGALLCSAVGDACLVWPEAFLHGVAAFAAAHLLYLWAFGLTPL QPGLLLLVILAALPYYGLLLWHLPPDLVLALTAYSLALATMLWRGLARGGSTGWGALLFT LSDTTLAWNAFAQPLPHARLVVMTTYYSAQVLISLSVSQSPKLKPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cript Mouse Gene Knockout Kit (CRISPR)
KN503829 1 Kit

Cript Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human NPRC/NPR3 (C-Fc)
PKSH034022-01 10 µg

Recombinant Human NPRC/NPR3 (C-Fc)

Sign In for Pricing
View Details
Recombinant Human NPRC/NPR3 (C-Fc)
PKSH034022-02 50 µg

Recombinant Human NPRC/NPR3 (C-Fc)

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF594 conjugate, 0.1mg/mL
BNC941953-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SHANK1 activation kit by CRISPRa
GA109481 1 Kit

Human SHANK1 activation kit by CRISPRa

Sign In for Pricing
View Details
HERV-FRD (ERVFRD-1) (N-term) Rabbit Polyclonal Antibody
AP52032PU-N 400 µL

HERV-FRD (ERVFRD-1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details