Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Lysoplasmalogenase (TMEM86B)

This Recombinant Pig Lysoplasmalogenase (TMEM86B) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

Lysoplasmalogenase, EC= 3.3.2.2, EC= 3.3.2.5, Transmembrane protein 86B

UniProt

F1RMN2

Expression Region

1-226

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPGKEGLPRKPRFSAQQLHVGKWLSPFFFTCAVYFLLWIPDDQPSWVGALVKCLPVLSL VVFLRAVDAGGGYSARLQGALLCSAVGDACLVWPEAFLHGVAAFAAAHLLYLWAFGLTPL QPGLLLLVILAALPYYGLLLWHLPPDLVLALTAYSLALATMLWRGLARGGSTGWGALLFT LSDTTLAWNAFAQPLPHARLVVMTTYYSAQVLISLSVSQSPKLKPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Omentum
CB501240 1 Block

Frozen Tissue Blocks, Omentum

Sign In for Pricing
View Details
IP3 Receptor Antibody
KC-36738-01 50 μL

IP3 Receptor Antibody

Sign In for Pricing
View Details
IP3 Receptor Antibody
KC-36738-02 100 µL

IP3 Receptor Antibody

Sign In for Pricing
View Details
IP3 Receptor Antibody
KC-36738-03 1 mL

IP3 Receptor Antibody

Sign In for Pricing
View Details
SCUBE1 (NM_173050) Human Over-expression Lysate
LC403543 20 µg

SCUBE1 (NM_173050) Human Over-expression Lysate

Sign In for Pricing
View Details
Cplane2 Mouse Gene Knockout Kit (CRISPR)
KN515159 1 Kit

Cplane2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details