Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup B Uncharacterized protein NMB2020 (NMB2020)

This Recombinant Neisseria meningitidis serogroup B Uncharacterized protein NMB2020 (NMB2020) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Uncharacterized protein NMB2020

UniProt

P63702

Expression Region

1-227

Origin

Neisseria meningitidis serogroup B (strain MC58)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQHDVYDYTAHTVSKNTVLQKTYRLLGFSFIPASAGAALAANAGFNFYAAFGSRWIGFAV VLAFFYGMIHFIEKNRYSNTGVTLLMVFTFGMGVLIGPVLQYALHIADGAKIVGIAAAMT AAVFLTMSALARRTRLDMNALGRFLTVGAVILMVAVVANLFLGIPALALTISAGFVLFSS LMIMWQVRTVIDGGEDSHISAALTLFISLYNIFSSLLNILLSLNGED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-100 1x 100 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL
BNC940745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF640R conjugate, 0.1mg/mL
BNC402556-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF647 conjugate, 0.1mg/mL
BNC471798-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF647 conjugate, 0.1mg/mL
BNC470396-100 1x 100 µL

Ep-CAM / CD326 (323/A3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5 + ASTRO/789), CF555 conjugate, 0.1mg/mL
BNC550898-500 1x 500 µL

GFAP (GA-5 + ASTRO/789), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details