Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Delta-type opioid receptor (OPRD1)

This Recombinant Pig Delta-type opioid receptor (OPRD1) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Delta-type opioid receptor, D-OR-1, DOR-1

UniProt

P79291

Expression Region

1-228

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNM FTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTRPR DGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILVITVCYGLMLLRLRSVRLLSGSKEK DRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiLink™ Rapid trFluor™ Eu Antibody Labeling Kit *Microscale Optimized for Labeling 50 ug Antibody Per Reaction*
1300-AAT 2 Labelings

ReadiLink™ Rapid trFluor™ Eu Antibody Labeling Kit *Microscale Optimized for Labeling 50 ug Antibody Per Reaction*

Sign In for Pricing
View Details
Perforin (PRF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D7]
TA814190BM 100 µL

Perforin (PRF1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3D7]

Sign In for Pricing
View Details
Recombinant RAF1 (phospho S621) Antibody
RC-16370-01 50 μL

Recombinant RAF1 (phospho S621) Antibody

Sign In for Pricing
View Details
Recombinant RAF1 (phospho S621) Antibody
RC-16370-02 100 µL

Recombinant RAF1 (phospho S621) Antibody

Sign In for Pricing
View Details
Recombinant RAF1 (phospho S621) Antibody
RC-16370-03 1 mL

Recombinant RAF1 (phospho S621) Antibody

Sign In for Pricing
View Details
XFD350 amine
70001-AAT 1 mg

XFD350 amine

Sign In for Pricing
View Details