Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0790 (MJ0790)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0790 (MJ0790) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0790

UniProt

Q58200

Expression Region

1-229

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNWKGHTILGIIFGLPFISSPEQIFLALAGALYPDLDHDVKEDIVKRGLLISGGIVFINI LLYFFDKHLFNVDLFILGVLILLIYLIPYFSDHRGLTHTFWSLLFVSSILGYLAYKLSFI SSVFAGLISLLMVTNEVLLGRVMIFAVFAWAVLDILNPNINVNGALYYILPVVFGYLSHL VGDTMTPAGVRAFYPLSNYKLRKKEGYILVAIWALMAVYVWKYMILSLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5430425J12Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3358304 1.0 µg DNA

5430425J12Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
centlein CRISPR Activation Plasmid (h2)
sc-412363-ACT-2 20 µg

centlein CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
MTF2 (NM_001164391) Human Tagged ORF Clone Lentiviral Particle
RC228406L4V 200 µL

MTF2 (NM_001164391) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human PGPEP1 Antibody (Biotin Conjugate)
33397-05121 150 µg

Human PGPEP1 Antibody (Biotin Conjugate)

Sign In for Pricing
View Details
ZNF2 (C-2)
sc-515483 200 µg/mL

ZNF2 (C-2)

Sign In for Pricing
View Details
Protein CASP Antibody
orb1730829 100 µL

Protein CASP Antibody

Sign In for Pricing
View Details