Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a (ATP6)

This Recombinant ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P24499

Expression Region

1-229

Origin

Trypanosoma brucei brucei

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFLFFFCDLFWLRLLLCMYYCVSRLCFIVYFNCLMLIFDFLLFCLFDLYLFVGLCLFLLL WFMLFNLYSLILYYCITYLNLYLLFCIVFLLYIAFLFLFCFLCDFFLFNNLLVGDSFMDV FFIRFLLCFLECFSLLCRCLSTFLRLFCNLLSSHFLLLMFFDFFYFIFVFFFYGVFCYFI LFIFVFCFCLLFYVFLYLLDLFAAILQLFIFCNMILQLIMDFLLFLLFV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), Biotin conjugate, 0.1mg/mL
BNCB0988-100 1x 100 µL

CD54 (W-CAM-1; same as Wehi-CAM-1 or 1H4), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
4-Aminobutyric-2,2-d2 Acid
TRC-A602921-25MG 25 mg

4-Aminobutyric-2,2-d2 Acid

Sign In for Pricing
View Details
Menthol-d4 (mixture of diastereomers)
TRC-M218902-25MG 25 mg

Menthol-d4 (mixture of diastereomers)

Sign In for Pricing
View Details
Ethyl Olivetolate
TRC-E388620-10G 10 g

Ethyl Olivetolate

Sign In for Pricing
View Details
3,5-Octadien-2-one
TRC-O493910-250MG 250 mg

3,5-Octadien-2-one

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF405S conjugate, 0.1mg/mL
BNC040940-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details