Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus pyogenes serotype M3 Uncharacterized membrane protein SPs1599 (SPs1599)

This Recombinant Streptococcus pyogenes serotype M3 Uncharacterized membrane protein SPs1599 (SPs1599) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SPs1599

UniProt

P0DA11

Expression Region

1-229

Origin

Streptococcus pyogenes serotype M3 (strain SSI-1)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRENLISILVNQPMIYYG AAIIELILVFVASGAARKNTPAALPIFLIYAALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nectin-4 Recombinant Rabbit monoclonal Antibody
HA751315 100 µL

Nectin-4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ZNF281 Polyclonal Antibody
E-AB-18446-01 20 µL

ZNF281 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF281 Polyclonal Antibody
E-AB-18446-02 60 µL

ZNF281 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF281 Polyclonal Antibody
E-AB-18446-03 120 µL

ZNF281 Polyclonal Antibody

Sign In for Pricing
View Details
ZNF281 Polyclonal Antibody
E-AB-18446-04 200 µL

ZNF281 Polyclonal Antibody

Sign In for Pricing
View Details
Fmoc-D-propargylglycine
TRC-F657615-500MG 500 mg

Fmoc-D-propargylglycine

Sign In for Pricing
View Details