Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein SpyM3_0260 (SpyM3_0260)

This Recombinant Uncharacterized membrane protein SpyM3_0260 (SpyM3_0260) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SpyM3_0260

UniProt

P0DA10

Expression Region

1-229

Origin

Streptococcus pyogenes serotype M3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRENLISILVNQPMIYYG AAIIELILVFVASGAARKNTPAALPIFLIYAALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFEB Antibody
8C10428-AAT 50 µg

TFEB Antibody

Sign In for Pricing
View Details
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF488A conjugate, 0.1mg/mL
BNC881867-500 1x 500 µL

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PLCXD2 activation kit by CRISPRa
GA116884 1 Kit

Human PLCXD2 activation kit by CRISPRa

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF488A conjugate, 0.1mg/mL
BNC882000-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD42b Rabbit Polyclonal Antibody
ER1803-26 100 µL

CD42b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Pentraxin 3 Antibody
RC-15087-01 50 μL

Recombinant Pentraxin 3 Antibody

Sign In for Pricing
View Details