Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein SpyM3_0260 (SpyM3_0260)

This Recombinant Uncharacterized membrane protein SpyM3_0260 (SpyM3_0260) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein SpyM3_0260

UniProt

P0DA10

Expression Region

1-229

Origin

Streptococcus pyogenes serotype M3

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDHVIYTQSDVGLNQFFAKIYSLVGMGVGLSAFVSYLMLYPFRENLISILVNQPMIYYG AAIIELILVFVASGAARKNTPAALPIFLIYAALNGFTLSFIIVAYAQTTVFQAFLSSAAV FFAMSIIGVKTKRDMSGLRKAMFAALIGVVVASLINLFIGSGMMSYVISVISVLIFSGLI ASDNQMIKRVYQATNGQVGDGWAVAMALSLYLDFINLFISLLRIFGRND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Chloro-2-furaldehyde
TRC-C381980-50MG 50 mg

5-Chloro-2-furaldehyde

Sign In for Pricing
View Details
HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF640R conjugate, 0.1mg/mL
BNC401656-500 1x 500 µL

HLA-DP/-DQ/-DR (MHC II) (CR3/43), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tube holder, 96 x 0.2ml, 12 x PCR strips or one PCR plate (R2024 and H2024 Only)
R2020-PCR 1 Each

Tube holder, 96 x 0.2ml, 12 x PCR strips or one PCR plate (R2024 and H2024 Only)

Sign In for Pricing
View Details
OR5A1 (NM_001004728) Human Over-expression Lysate
LC423911 20 µg

OR5A1 (NM_001004728) Human Over-expression Lysate

Sign In for Pricing
View Details
TentaGel® R HMPA
R28015.100G 100 g

TentaGel® R HMPA

Sign In for Pricing
View Details
C1ql4 Mouse Gene Knockout Kit (CRISPR)
KN502349 1 Kit

C1ql4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details