Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Lysoplasmalogenase (Tmem86b)

This Recombinant Rat Lysoplasmalogenase (Tmem86b) spans the amino acid sequence from region 1-233.

Product Specifications

Product Name Alternative

Lysoplasmalogenase, EC= 3.3.2.2, EC= 3.3.2.5, Transmembrane protein 86B

UniProt

B0BNF0

Expression Region

1-233

Origin

Rattus norvegicus (Rat)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPCCDPYPWIGLNVGRLSSFPLLKYPQVRRWLAPFIVACSLYFLLWIPEDQPSWVSALVK CQPILCLVLFLWAVAPGGSYTWLLQGALTCSAVGDACLIWPEAFFYGMAVFSVAHLLYLW AFGLSPLQPGLLLCTTLASLTYYSFLLLHLEPNMVLPVAAYGLILNTMLWRGLVLGRSAG WGAVLFIFSDGVLAWDTFVYTLPFARLVTMSTYYAAQLLLTLSALRSPGLKTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCL1 (BH3 Domain) Rabbit Polyclonal Antibody
AP11305PU-N 400 µL

MCL1 (BH3 Domain) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
D,L-Alpha-Hydroxy Myristic Acid
TRC-H948500-10MG 10 mg

D,L-Alpha-Hydroxy Myristic Acid

Sign In for Pricing
View Details
Human Nuclear Antigen (235-1), Biotin conjugate, 0.1mg/mL
BNCB0099-500 1x 500 µL

Human Nuclear Antigen (235-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit
E-UNEL-H0349-01 5x 96 Tests

Uncoated Human VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit
E-UNEL-H0349-02 15x 96 Tests

Uncoated Human VEGFR3/Flt4 (Vascular Endothelial Cell Growth Factor Receptor 3) ELISA Kit

Sign In for Pricing
View Details
5-Deoxy-D-arabinitol
TRC-D288040-500MG 500 mg

5-Deoxy-D-arabinitol

Sign In for Pricing
View Details