Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanosphaerula palustris Putative cobalt transport protein CbiM 2 (cbiM2)

This Recombinant Methanosphaerula palustris Putative cobalt transport protein CbiM 2 (cbiM2) spans the amino acid sequence from region 1-235.

Product Specifications

Product Name Alternative

Putative cobalt transport protein CbiM 2, Energy-coupling factor transporter probable substrate-capture protein CbiM 2, ECF transporter S component CbiM 2

UniProt

B8GEB7

Expression Region

1-235

Origin

Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHIMEGFLPAGWCLVWWLIALPFLVMGIIQLRRMMKEDREYLPLLGVCGAFIFILSALKL PSVTGSCSHPTGTGLSTICFGYCVTAVVGAIVLLFQALLLAHGGLSTMGANMVSMAIGGP IAGYAVYKLMKDTSINIYVTVFLASAVADIVTYIITSFELALAYPAQVGGFLASFSAFFS IFAITQIPLSIMEGVVLALVFKYIIQLKPEIILKLHVFSEEQIAKARLAGDAEVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL
BNC040177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-100 1x 100 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF488A conjugate, 0.1mg/mL
BNC882110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF488A conjugate, 0.1mg/mL
BNC881602-500 1x 500 µL

CD56 / NCAM1 / NKH1 (Neuronal Cell Marker) (ERIC-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details