Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Lycopene beta-cyclase (crtY)

This Recombinant Halobacterium salinarum Lycopene beta-cyclase (crtY) spans the amino acid sequence from region 1-237.

Product Specifications

Product Name Alternative

Lycopene beta-cyclase, EC= 5.5.1.19

UniProt

B0R753

Expression Region

1-237

Origin

Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSYLTFLAVAVGPPLVALGVVRAARWDGDRARAAGVGILLALALSYTTPWDNYLIATG VWWYGEGTVVGRLWQMPIEEYLFVITQTLLTGLWVQALPLRPTAGFSPTRRDAVLGALAG VLVGCGGAVLLTVDATFYIGAIIAWAAPVLALQWAVGWRYLWRRRRVFAAAVLVPTLFLS AADRYAIADGIWILAGQYTTGITVLGLPIEEGAFFFVTNVFVSQGLILYAWVLARWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Clathrin heavy chain Rabbit pAb, PE-Cy5 conjugated
orb2856432 100 µL

Clathrin heavy chain Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
DCAF12L1 (NM_178470) Human Over-expression Lysate
LS139170-100ug 100 µg

DCAF12L1 (NM_178470) Human Over-expression Lysate

Sign In for Pricing
View Details
Patritumab deruxtecan
BUP20280-01 1 mg

Patritumab deruxtecan

Sign In for Pricing
View Details
Patritumab deruxtecan
BUP20280-02 5 mg

Patritumab deruxtecan

Sign In for Pricing
View Details
Patritumab deruxtecan
BUP20280-03 10 mg

Patritumab deruxtecan

Sign In for Pricing
View Details
Patritumab deruxtecan
BUP20280-04 25 mg

Patritumab deruxtecan

Sign In for Pricing
View Details