Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Lycopene beta-cyclase (crtY)

This Recombinant Halobacterium salinarum Lycopene beta-cyclase (crtY) spans the amino acid sequence from region 1-237.

Product Specifications

Product Name Alternative

Lycopene beta-cyclase, EC= 5.5.1.19

UniProt

Q9HNE5

Expression Region

1-237

Origin

Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) (Halobacterium halobium)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTSYLTFLAVAVGPPLVALGVVRAARWDGDRARAAGVGILLALALSYTTPWDNYLIATG VWWYGEGTVVGRLWQMPIEEYLFVITQTLLTGLWVQALPLRPTAGFSPTRRDAVLGALAG VLVGCGGAVLLTVDATFYIGAIIAWAAPVLALQWAVGWRYLWRRRRVFAAAVLVPTLFLS AADRYAIADGIWILAGQYTTGITVLGLPIEEGAFFFVTNVFVSQGLILYAWVLARWR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pwwp2a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4774205 3x 1.0 µg

Pwwp2a sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Bovine Cathelicidin-1 ELISA Kit
MBS289402-01 48 Well

Bovine Cathelicidin-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Cathelicidin-1 ELISA Kit
MBS289402-02 96 Well

Bovine Cathelicidin-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Cathelicidin-1 ELISA Kit
MBS289402-03 5x 96 Well

Bovine Cathelicidin-1 ELISA Kit

Sign In for Pricing
View Details
Bovine Cathelicidin-1 ELISA Kit
MBS289402-04 10x 96 Well

Bovine Cathelicidin-1 ELISA Kit

Sign In for Pricing
View Details
TNF Rabbit Polyclonal Antibody (HRP)
orb2119388 100 µL

TNF Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details