Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein ywaF (ywaF)

This Recombinant Bacillus subtilis Uncharacterized protein ywaF (ywaF) spans the amino acid sequence from region 1-237.

Product Specifications

Product Name Alternative

Uncharacterized protein ywaF, ORF1

UniProt

P25149

Expression Region

1-237

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKYVQSDYKHDPFHLFSTEHVVTLAIISLLAILLFLFQDEVKQPRASRFLRSLFVFLLL GSQIGYQIWMVATDRWSVRTSLPLQLSDLSVYLSAIMLVTKSRKLFVFLFFVGIGSSIQA LATPDLGMFSFPHIRYILFFISHGSVFLSCLLMAVIGTYRMGQRSLWVTVLLVNVYGVCI FLIDRWLGANYMYLTKKPGGSSLLDVLGPWPWYIVSAEAITIASFFILYWLYRIFKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- ((2,5-Difluorophenyl) thio) butan-2-one
PC100644-01 100 mg

3- ((2,5-Difluorophenyl) thio) butan-2-one

Sign In for Pricing
View Details
3- ((2,5-Difluorophenyl) thio) butan-2-one
PC100644-02 250 mg

3- ((2,5-Difluorophenyl) thio) butan-2-one

Sign In for Pricing
View Details
3- ((2,5-Difluorophenyl) thio) butan-2-one
PC100644-03 500 mg

3- ((2,5-Difluorophenyl) thio) butan-2-one

Sign In for Pricing
View Details
3- ((2,5-Difluorophenyl) thio) butan-2-one
PC100644-04 5 g

3- ((2,5-Difluorophenyl) thio) butan-2-one

Sign In for Pricing
View Details
3- ((2,5-Difluorophenyl) thio) butan-2-one
PC100644-05 10 g

3- ((2,5-Difluorophenyl) thio) butan-2-one

Sign In for Pricing
View Details
Rabbit Apolipoprotein B-48 (ApoB48) ELISA Kit
CK-bio-17207-01 48 Tests

Rabbit Apolipoprotein B-48 (ApoB48) ELISA Kit

Sign In for Pricing
View Details