Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Treponema pallidum UPF0073 membrane protein TP_1037 (TP_1037)

This Recombinant Treponema pallidum UPF0073 membrane protein TP_1037 (TP_1037) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

UPF0073 membrane protein TP_1037

UniProt

O84000

Expression Region

1-238

Origin

Treponema pallidum (strain Nichols)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKIVNADGSDAICPASAACAKSIRSYQESYSLGEEIANAVTHGIGVGLSIVALVLLVVR AVHYTPADLTARYVVGFSVFGSSLIVLYLCSTLYHALPRGAKYVFGVIDHCCIYVLIAGT YTASCLTTLYGAIGWTVFGVIWGLACSGSVIYSVFGHRVRWLSLVMYIAMGWLVVFVAKP LRERLPEISFLFLVLGGVLYTVGCVFYALKRIKWTHTIWHMFVIGGSVMHFFSLYLSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD95 (B-R18), CF647 conjugate, 0.1mg/mL
BNC470305-500 1x 500 µL

CD95 (B-R18), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL
BNC040146-500 1x 500 µL

CD10 (CB-CALLA), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-500 1x 500 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-100 1x 100 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details