Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Monocyte to macrophage differentiation protein (MMD)

This Recombinant Human Monocyte to macrophage differentiation protein (MMD) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Monocyte to macrophage differentiation protein, Progestin and adipoQ receptor family member 11, Progestin and adipoQ receptor family member XI

UniProt

Q15546

Expression Region

1-238

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRFKNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFMRHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF740 conjugate, 0.1mg/mL
BNC742452-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/2452), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cell Cycle Assay Kit (Red Fluorescence)
E-CK-A351-01 20 Assays

Cell Cycle Assay Kit (Red Fluorescence)

Sign In for Pricing
View Details
Cell Cycle Assay Kit (Red Fluorescence)
E-CK-A351-02 50 Assays

Cell Cycle Assay Kit (Red Fluorescence)

Sign In for Pricing
View Details
Cell Cycle Assay Kit (Red Fluorescence)
E-CK-A351-03 100 Assays

Cell Cycle Assay Kit (Red Fluorescence)

Sign In for Pricing
View Details
(3a)-Allopregnanolone
TRC-A547100-5MG 5 mg

(3a)-Allopregnanolone

Sign In for Pricing
View Details
GRB2 Rabbit Polyclonal Antibody
AP13279PU-N 400 µL

GRB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details