Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mannose-P-dolichol utilization defect 1 protein homolog (F38E1.9)

This Recombinant Mannose-P-dolichol utilization defect 1 protein homolog (F38E1.9) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Mannose-P-dolichol utilization defect 1 protein homolog

UniProt

Q20157

Expression Region

1-238

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNDIIQSLFPGNCFEELLINFNFFHPTCPKAVLSRGLGFAITLGSILLFVPQILKIQAAR SAQGISAASQLLALVGAIGTASYSYRSGFVFSGWGDSFFVAVQLVIIILQIFLFSGQTML SVGFLGIVSAVAYGVVSKSIPMQTLTAVQTAGIPIVVVSKLLQISQNYRAQSTGQLSLIS VFLQFAGTLARVFTSVQDTGDMLLIVSYSTAAVLNGLIFAQFFMYWSHSESAAKKKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL
BNC680032-500 1x 500 µL

MUC2 (CCP58), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF740 conjugate, 0.1mg/mL
BNC740193-500 1x 500 µL

CD86 (BU63), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF740 conjugate, 0.1mg/mL
BNC740175-500 1x 500 µL

CD46 (122.2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF488A conjugate, 0.1mg/mL
BNC881975-100 1x 100 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details