Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Monocyte to macrophage differentiation protein (Mmd)

This Recombinant Rat Monocyte to macrophage differentiation protein (Mmd) spans the amino acid sequence from region 1-238.

Product Specifications

Product Name Alternative

Monocyte to macrophage differentiation protein, Macrophage/microglia activation-associated factor, MAF, Progestin and adipoQ receptor family member XI

UniProt

Q719N3

Expression Region

1-238

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation; Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQFRNRFQRFMNHRAPANGRYKPTCYEHAANCYTHAFLIVPAIVGSALLHRLSDDCWEKI TAWIYGMGLCALFIVSTVFHIVSWKKSHLRTVEHCFHMCDRMVIYFFIAASYAPWLNLRE LGPLASHMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQE LACGGLIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFIRHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF543 Antibody (N-term)
MBS9209754-01 0.08 mL

ZNF543 Antibody (N-term)

Sign In for Pricing
View Details
ZNF543 Antibody (N-term)
MBS9209754-02 0.4 mL

ZNF543 Antibody (N-term)

Sign In for Pricing
View Details
ZNF543 Antibody (N-term)
MBS9209754-03 5x 0.4 mL

ZNF543 Antibody (N-term)

Sign In for Pricing
View Details
Mouse Rtel1 Pre-designed siRNA Set A
SI112356A 1 Each

Mouse Rtel1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Cytokeratin 5/8 Antibody
orb749943-01 20 µg

Cytokeratin 5/8 Antibody

Sign In for Pricing
View Details
Cytokeratin 5/8 Antibody
orb749943-02 100 µg

Cytokeratin 5/8 Antibody

Sign In for Pricing
View Details