Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium smegmatis Cobalamin synthase (cobS)

This Recombinant Mycobacterium smegmatis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0R065

Expression Region

1-241

Origin

Mycobacterium smegmatis (strain ATCC 700084 / mc (2) 155)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRSLAGAFAFGTVLPVRASAGVGRGALTALPFVGLALGALAAAVVWAGGWAFAAGSPLP GVLAVAVLLLATRGLHIDGFCDTVDGLGCYGPPERALAVMRDGSAGPFGVAAVVVVIAVQ ALTFAELSVLAVVTAVVAGRVAVVAACRRSVPAAAGSTLGAAVAGSQPRWVVAGWIVALA ALAVFACPRPWQGPLAVLVAIGCSLALVAHCVRRFGGITGDVLGAAVEVTTTLAALGLAI G

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOX4 Human Gene Knockout Kit (CRISPR)
KN402171 1 Kit

TOX4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Dehydro Ascorbic Acid
TRC-D229250-500MG 500 mg

L-Dehydro Ascorbic Acid

Sign In for Pricing
View Details
Mouse CFH Antibody Pair Set
E-KAB-0300 50 µL & 100 µg

Mouse CFH Antibody Pair Set

Sign In for Pricing
View Details
Eserethol
TRC-E146220-1MG 1 mg

Eserethol

Sign In for Pricing
View Details
Ptgfr Mouse Gene Knockout Kit (CRISPR)
KN514176 1 Kit

Ptgfr Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human COPS7A activation kit by CRISPRa
GA109454 1 Kit

Human COPS7A activation kit by CRISPRa

Sign In for Pricing
View Details