Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium smegmatis Cobalamin synthase (cobS)

This Recombinant Mycobacterium smegmatis Cobalamin synthase (cobS) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A0R065

Expression Region

1-241

Origin

Mycobacterium smegmatis (strain ATCC 700084 / mc (2) 155)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRSLAGAFAFGTVLPVRASAGVGRGALTALPFVGLALGALAAAVVWAGGWAFAAGSPLP GVLAVAVLLLATRGLHIDGFCDTVDGLGCYGPPERALAVMRDGSAGPFGVAAVVVVIAVQ ALTFAELSVLAVVTAVVAGRVAVVAACRRSVPAAAGSTLGAAVAGSQPRWVVAGWIVALA ALAVFACPRPWQGPLAVLVAIGCSLALVAHCVRRFGGITGDVLGAAVEVTTTLAALGLAI G

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptms Mouse Gene Knockout Kit (CRISPR)
KN514194 1 Kit

Ptms Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
QuantiFluo™ Ammonia Assay Kit
DNH3-200 200 Tests

QuantiFluo™ Ammonia Assay Kit

Sign In for Pricing
View Details
Recombinant Human SUMO3/SMT3A Protein
PKSH033068-01 10 µg

Recombinant Human SUMO3/SMT3A Protein

Sign In for Pricing
View Details
Recombinant Human SUMO3/SMT3A Protein
PKSH033068-02 50 µg

Recombinant Human SUMO3/SMT3A Protein

Sign In for Pricing
View Details
EDG7 (LPAR3) Rabbit Polyclonal Antibody
AP01312PU-N 100 µg

EDG7 (LPAR3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human FGD3 activation kit by CRISPRa
GA113939 1 Kit

Human FGD3 activation kit by CRISPRa

Sign In for Pricing
View Details