Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fervidobacterium nodosum Cobalamin synthase (cobS)

This Recombinant Fervidobacterium nodosum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A7HMT2

Expression Region

1-241

Origin

Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQDSLKDILLTFSFISRLPVKLGELSDWEVRMKRIPAYFTIVGYIPGLIYFTGSFLSLNF GIIAPLLSIVLGFYLFDLFHFDGLLDTLDGFLNQSSKSRRLEIMSKGNVGPFAVFYGVLY VIVFWELITSIEPVAFVFGSVFGRYTMDVVLVFSKPAKNEGLGAMLFPFNRFLLVPATLF TLPLLLIDVKLFLVSIFSSWLVGFLISKVSEKQIGGVTGDVLGGSCLIGQIVVLLILNYL I

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UEVLD Rabbit Polyclonal Antibody
TA383066 100 µL

UEVLD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF405S conjugate, 0.1mg/mL
BNC041395-100 1x 100 µL

CD31 / PECAM-1 (Endothelial Cell Marker) (C31/1395R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Xlr4c activation kit by CRISPRa
GA209360 1 Kit

Mouse Xlr4c activation kit by CRISPRa

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF647 conjugate, 0.1mg/mL
BNC471540-100 1x 100 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (rVWF/1465), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pure Solanum tuberosum (Potato) -STA-
L-4701-5 5 mg

Pure Solanum tuberosum (Potato) -STA-

Sign In for Pricing
View Details
NSRP1 Human Gene Knockout Kit (CRISPR)
KN424892 1 Kit

NSRP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details