Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Fervidobacterium nodosum Cobalamin synthase (cobS)

This Recombinant Fervidobacterium nodosum Cobalamin synthase (cobS) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Cobalamin synthase, EC= 2.-.-.-

UniProt

A7HMT2

Expression Region

1-241

Origin

Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQDSLKDILLTFSFISRLPVKLGELSDWEVRMKRIPAYFTIVGYIPGLIYFTGSFLSLNF GIIAPLLSIVLGFYLFDLFHFDGLLDTLDGFLNQSSKSRRLEIMSKGNVGPFAVFYGVLY VIVFWELITSIEPVAFVFGSVFGRYTMDVVLVFSKPAKNEGLGAMLFPFNRFLLVPATLF TLPLLLIDVKLFLVSIFSSWLVGFLISKVSEKQIGGVTGDVLGGSCLIGQIVVLLILNYL I

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS501116 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Urinary bladder
CS703832 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details
Tal1 (BTL73), CF740 conjugate, 0.1mg/mL
BNC742852-500 1x 500 µL

Tal1 (BTL73), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TIRAP (NM_001039661) Human Over-expression Lysate
LY422104 100 µg

TIRAP (NM_001039661) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Parotid gland
CS800942 5x 5 µm

Tissue FFPE Sections, Parotid gland

Sign In for Pricing
View Details
AdSS 2 (ADSS) Rabbit Polyclonal Antibody
TA373330 100 µL

AdSS 2 (ADSS) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details