Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaplasma marginale ATP synthase subunit a (atpB)

This Recombinant Anaplasma marginale ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5P9R8

Expression Region

1-241

Origin

Anaplasma marginale (strain St. Maries)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPLEQFRVTKLLDIPALWGIDLSFTNCSLVMVLASVSSILLLCWALRKINVVPGPSQTA VELIYGFVANTLESNAGAEGLRYIPLVMTTFLFVLACNLVGILPFGFTATSHLSVTLALS LVVCTAITVIGFRHQGLHFLRIFLPEGTPLWLAPMMVFIKLFAYVARPVSLAIRLAANMI AGHTIIAVIADFVLKMHLVLAPLPFAFIMGLIAFEIFVAILQAYIFTVLTTVYLSDAVAG H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2’-Bisnaloxone-mono-alcohol
TRC-B859220-1MG 1 mg

2,2’-Bisnaloxone-mono-alcohol

Sign In for Pricing
View Details
MUC3 (Mucin 3) (MUC3/2992R), CF568 conjugate, 0.1mg/mL
BNC682992-100 1x 100 µL

MUC3 (Mucin 3) (MUC3/2992R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Pirh2 Antibody
RC-16386-01 50 μL

Recombinant Pirh2 Antibody

Sign In for Pricing
View Details
Recombinant Pirh2 Antibody
RC-16386-02 100 µL

Recombinant Pirh2 Antibody

Sign In for Pricing
View Details
Recombinant Pirh2 Antibody
RC-16386-03 1 mL

Recombinant Pirh2 Antibody

Sign In for Pricing
View Details
4-Hydroxy Moxonidine
TRC-H947735-25MG 25 mg

4-Hydroxy Moxonidine

Sign In for Pricing
View Details