Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaplasma marginale ATP synthase subunit a (atpB)

This Recombinant Anaplasma marginale ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5P9R8

Expression Region

1-241

Origin

Anaplasma marginale (strain St. Maries)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPLEQFRVTKLLDIPALWGIDLSFTNCSLVMVLASVSSILLLCWALRKINVVPGPSQTA VELIYGFVANTLESNAGAEGLRYIPLVMTTFLFVLACNLVGILPFGFTATSHLSVTLALS LVVCTAITVIGFRHQGLHFLRIFLPEGTPLWLAPMMVFIKLFAYVARPVSLAIRLAANMI AGHTIIAVIADFVLKMHLVLAPLPFAFIMGLIAFEIFVAILQAYIFTVLTTVYLSDAVAG H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloro-1,3,2-dioxaphospholane-2-oxide (Technical Grade)
TRC-C365758-1G 1 g

2-Chloro-1,3,2-dioxaphospholane-2-oxide (Technical Grade)

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF568 conjugate, 0.1mg/mL
BNC681798-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sucrose Monolaurate
TRC-S080898-500MG 500 mg

Sucrose Monolaurate

Sign In for Pricing
View Details
CD19 Polyclonal Antibody
E-AB-70018-01 60 µL

CD19 Polyclonal Antibody

Sign In for Pricing
View Details
CD19 Polyclonal Antibody
E-AB-70018-02 120 µL

CD19 Polyclonal Antibody

Sign In for Pricing
View Details
CD19 Polyclonal Antibody
E-AB-70018-03 200 µL

CD19 Polyclonal Antibody

Sign In for Pricing
View Details