Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anaplasma marginale ATP synthase subunit a (atpB)

This Recombinant Anaplasma marginale ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q5P9R8

Expression Region

1-241

Origin

Anaplasma marginale (strain St. Maries)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPLEQFRVTKLLDIPALWGIDLSFTNCSLVMVLASVSSILLLCWALRKINVVPGPSQTA VELIYGFVANTLESNAGAEGLRYIPLVMTTFLFVLACNLVGILPFGFTATSHLSVTLALS LVVCTAITVIGFRHQGLHFLRIFLPEGTPLWLAPMMVFIKLFAYVARPVSLAIRLAANMI AGHTIIAVIADFVLKMHLVLAPLPFAFIMGLIAFEIFVAILQAYIFTVLTTVYLSDAVAG H

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Genomic DNA, Prostate
CD563601 5 µg

Tissue Genomic DNA, Prostate

Sign In for Pricing
View Details
MTHFD2 (MTHFD2L) (NM_001144978) Human Over-expression Lysate
LY428620 100 µg

MTHFD2 (MTHFD2L) (NM_001144978) Human Over-expression Lysate

Sign In for Pricing
View Details
CSK Recombinant Rabbit Monoclonal Antibody [PSH06-24]
HA722656 100 µL

CSK Recombinant Rabbit Monoclonal Antibody [PSH06-24]

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF740 conjugate, 0.1mg/mL
BNC743019-500 1x 500 µL

CD47 / IAP (Integrin Associated Protein) (CD47/3019), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Angiopoietin-2 Antibody
KC-2990-01 50 μL

Angiopoietin-2 Antibody

Sign In for Pricing
View Details
Angiopoietin-2 Antibody
KC-2990-02 100 µL

Angiopoietin-2 Antibody

Sign In for Pricing
View Details