Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L68 (MIMI_L68)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L68 (MIMI_L68) spans the amino acid sequence from region 1-241.

Product Specifications

Product Name Alternative

Uncharacterized protein L68

UniProt

Q5UPE7

Expression Region

1-241

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDYFSIIKITMITEIYFQYVIYILCFGVLLLLKSESDRLLWLHLVSILVGLIANYEMKFN VLFAMFHSAVHNLWPFLKNTGYDNTEKSVYDVICHTIMVVICYHQICYTENAVTNNYYTF HLFSVMIIIGALFNCVVSGKAIGSNDRFLHSLFEYTTIFQALSTGYWVATMLWYHHLDNI HFYSHWIIWIGLMTINWFVYKFYPNLVGISMRYKYVEAVFIVCTWYSGIISSPLIKYINV Y

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBXD5 (UBXN11) (NM_001077262) Human Recombinant Protein
PROTQ5T124 20 µg

UBXD5 (UBXN11) (NM_001077262) Human Recombinant Protein

Sign In for Pricing
View Details
GPR146 Antibody - middle region
ARP94123_P050-25UL 25 µL

GPR146 Antibody - middle region

Sign In for Pricing
View Details
ZUFSP CRISPRa sgRNA lentivector (set of three targets)(Mouse)
51991124 3x 1.0µg DNA

ZUFSP CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Anti-MERS-CoV Spike Antibody (8P799)
TMAY-03611-01 20 µL

Anti-MERS-CoV Spike Antibody (8P799)

Sign In for Pricing
View Details
Anti-MERS-CoV Spike Antibody (8P799)
TMAY-03611-02 100 µL

Anti-MERS-CoV Spike Antibody (8P799)

Sign In for Pricing
View Details
ASB-6 Lentiviral Activation Particles (m)
sc-428315-LAC 200 µL

ASB-6 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details